PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g096780.1
Common NameMTR_8g096780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 391aa    MW: 43350.9 Da    PI: 8.2925
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g096780.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.9e-4199175278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC+adls++++yhrrhkvCe hsk+++v++ g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Medtr8g096780.1  99 CLVDGCQADLSNCRDYHRRHKVCELHSKTAQVTIGGHKQRFCQQCSRFHALEEFDEGKRSCRKRLDGHNRRRRKPQP 175
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-3392160IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.83896173IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-3997178IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3099172IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MEWSNLKAPS WDLTEMDQGT LNNIETMDGS IRRFGDYRTK GDFSVDLKLG HVGNSSTESG  60
LTKSKDVGGF TKMTSSSSST SGSSKRARAI NNGTQIVSCL VDGCQADLSN CRDYHRRHKV  120
CELHSKTAQV TIGGHKQRFC QQCSRFHALE EFDEGKRSCR KRLDGHNRRR RKPQPEPITR  180
SSSFLSNYQG TQLLPFSSSH VYPSTAMMNP TWVGGDVRLH SHNQHQQMHH LVDKQDLFLG  240
TTSSTSSYKE GKQVSFIQNN QPTAAATMNN QPLPASSMSR TFSRTNPFSE RYKMFCDNNT  300
SCALSLLSSP VPQTHDHPEN GLNQMVNTHS SFMQPLGLSL HDHSLGSVDS VLGSNDQSGH  360
CSSMYNMGSS ESHSQGNNNE ASPLFPFQWD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-28991721184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155172KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1447261e-115AC144726.6 Medicago truncatula chromosome 8 clone mth2-7k13, complete sequence.
GenBankAC1505051e-115AC150505.12 Medicago truncatula chromosome 8 clone mth2-99l2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446991.10.0squamosa promoter-binding 13A-like protein
TrEMBLA0A072TVW90.0A0A072TVW9_MEDTR; Squamosa promoter-binding 13A-like protein
STRINGGLYMA05G38180.101e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-72SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]